Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BANF1 Rabbit Polyclonal Antibody (HRP)

BANF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BAF, NGPS, BCRP1, D14S1460

UniProt

O75531

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human BANF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAF

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003851

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SV2A Antibody Picoband® Fluoro594 Conjugated
A03752-3-Fluoro594 100 µg/Vial

Anti-SV2A Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Btbd1 (NM_001011932) Rat Tagged ORF Clone Lentiviral Particle
RR215351L3V 200 µL

Btbd1 (NM_001011932) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-POGZ Antibody Picoband® Fluoro647 Conjugated
A06169-3-Fluoro647 100 µg/Vial

Anti-POGZ Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Human LIG3 Protein, His (Fc)-Avi-tagged
LIG3-1294H 50 µg

Recombinant Human LIG3 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Hemoglobin Subunit Zeta (HBZ) Antibody
abx233779 100 µg

Hemoglobin Subunit Zeta (HBZ) Antibody

Sign In for Pricing
View Details
CLIP discontinued
378249 200 µg

CLIP discontinued

Sign In for Pricing
View Details