Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSAD Rabbit Polyclonal Antibody (FITC)

CSAD Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSD, PCAP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001231635

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naca Rabbit Polyclonal Antibody (PerCP)
orb2474174 100 µL

Naca Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 650)
MBS6227976-01 0.1 mL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 650)

Sign In for Pricing
View Details
HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 650)
MBS6227976-02 5x 0.1 mL

HEYL (Hairy/Enhancer-of-Split Related with YRPW Motif-like, HRT3, MGC12623, bHLHb33) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Feline Sarcoma Virus Tyrosine-Protein Kinase Transforming Protein Kit (V-KIT)
VG2C160-01 1 mg

Recombinant Feline Sarcoma Virus Tyrosine-Protein Kinase Transforming Protein Kit (V-KIT)

Sign In for Pricing
View Details
Recombinant Feline Sarcoma Virus Tyrosine-Protein Kinase Transforming Protein Kit (V-KIT)
VG2C160-02 100 µg

Recombinant Feline Sarcoma Virus Tyrosine-Protein Kinase Transforming Protein Kit (V-KIT)

Sign In for Pricing
View Details
Recombinant Feline Sarcoma Virus Tyrosine-Protein Kinase Transforming Protein Kit (V-KIT)
VG2C160-03 20 µg

Recombinant Feline Sarcoma Virus Tyrosine-Protein Kinase Transforming Protein Kit (V-KIT)

Sign In for Pricing
View Details