Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LTB4R2 Rabbit Polyclonal Antibody (Biotin)

LTB4R2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BLT2, NOP9, BLTR2, JULF2, KPG_004, LTB4-R2, LTB4-R 2

UniProt

Q5KU28

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRTTPQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158164

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AOX1 Antibody, Biotin Conjugated
MBS7113673-01 0.05 mL

AOX1 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
AOX1 Antibody, Biotin Conjugated
MBS7113673-02 0.1 mL

AOX1 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
AOX1 Antibody, Biotin Conjugated
MBS7113673-03 5x 0.1 mL

AOX1 Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Dok3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6087406 1.0 µg DNA

Dok3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
E-oligos custom DNA oligo 200 nmol scale synthesis
EO-6400-02 1/Each

E-oligos custom DNA oligo 200 nmol scale synthesis

Sign In for Pricing
View Details
DAPP1 Mouse Monoclonal Antibody [Clone ID: OTI7D4]
TA810236S 30 µL

DAPP1 Mouse Monoclonal Antibody [Clone ID: OTI7D4]

Sign In for Pricing
View Details