Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEU2 Rabbit Polyclonal Antibody (Biotin)

NEU2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SIAL2

UniProt

Q9Y3R4

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTH

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC

NCBI Accession Number

NP_005374

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Printed with Looped cap Screw Cap Tube, Conical, PP, 2.0 mL, with EPDM ring Cap, Green - 1000 un, DNase/RNase free - ABDOS
P10358G 1000 Units/Pack

Printed with Looped cap Screw Cap Tube, Conical, PP, 2.0 mL, with EPDM ring Cap, Green - 1000 un, DNase/RNase free - ABDOS

Sign In for Pricing
View Details
Clavulanic acid ammonium
FC66067-01 250 mg

Clavulanic acid ammonium

Sign In for Pricing
View Details
Clavulanic acid ammonium
FC66067-02 500 mg

Clavulanic acid ammonium

Sign In for Pricing
View Details
Clavulanic acid ammonium
FC66067-03 1000 mg

Clavulanic acid ammonium

Sign In for Pricing
View Details
Clavulanic acid ammonium
FC66067-04 2000 mg

Clavulanic acid ammonium

Sign In for Pricing
View Details
SCAND3 Protein Vector (Human) (pPB-N-His)
PV057482 500 ng

SCAND3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details