Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGA2 Rabbit Polyclonal Antibody (Biotin)

ITGA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BR, GPIa, CD49B, HPA-5, VLA-2, VLAA2

UniProt

P17301

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ITGA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

126kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IF, WB

NCBI Accession Number

NP_002194

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131199-01 0.1 mL

FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131199-02 0.2 mL

FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131199-03 0.5 mL

FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131199-04 1 mL

FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131199-05 5 mL

FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details
FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)
MBS2131199-06 5x 5 mL

FITC Linked Monoclonal Antibody to Programmed Cell Death Protein 1 Ligand 1 (PDL1)

Sign In for Pricing
View Details