Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISP3 Rabbit Polyclonal Antibody (FITC)

CRISP3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Aeg2, CRS3, SGP28, CRISP-3, dJ442L6.3

UniProt

P54108

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_006052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Kynurenine-3-Monooxygenase (KMO), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031304 96 Tests

Multiplex Assay Kit for Kynurenine-3-Monooxygenase (KMO), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Bovine Vitamin D-Binding Protein (Gc) Elisa Kit
EKC31824 96 Tests

Bovine Vitamin D-Binding Protein (Gc) Elisa Kit

Sign In for Pricing
View Details
Sstr5 Rat shRNA Plasmid (Locus ID 25354)
TL709499 1 Kit

Sstr5 Rat shRNA Plasmid (Locus ID 25354)

Sign In for Pricing
View Details
LOC688459 Rat shRNA Lentiviral Particle (Locus ID 688459)
TL707988V 500 µL Each

LOC688459 Rat shRNA Lentiviral Particle (Locus ID 688459)

Sign In for Pricing
View Details
RSPH10B2 3'UTR Luciferase Stable Cell Line
TU022438 1.0 mL

RSPH10B2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Arthrobacter chlorophenolicus UPF0061 protein Achl_2066 (Achl_2066)
MBS1036052-01 0.02 mg (E-Coli)

Recombinant Arthrobacter chlorophenolicus UPF0061 protein Achl_2066 (Achl_2066)

Sign In for Pricing
View Details