Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Rabbit Polyclonal Antibody (Biotin)

DYRK2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tcn2 Antibody - N-terminal region : FITC (ARP48142_P050-FITC)
ARP48142_P050-FITC 100 µL

Tcn2 Antibody - N-terminal region : FITC (ARP48142_P050-FITC)

Sign In for Pricing
View Details
CPNE1 (NM_152928) Human Over-expression Lysate
LY407223 100 µg

CPNE1 (NM_152928) Human Over-expression Lysate

Sign In for Pricing
View Details
HIV-1 gp160, Soluble, Strain IIIB, Recombinant (Human Immunodeficiency Virus-1) (Biotin)
H6003-20F2 50 µg

HIV-1 gp160, Soluble, Strain IIIB, Recombinant (Human Immunodeficiency Virus-1) (Biotin)

Sign In for Pricing
View Details
KDM4D (NM_018039) Human Over-expression Lysate
LY402639 100 µg

KDM4D (NM_018039) Human Over-expression Lysate

Sign In for Pricing
View Details
GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)
MBS6419355-01 0.1 mL

GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)

Sign In for Pricing
View Details
GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)
MBS6419355-02 5x 0.1 mL

GRK5 (G-Protein-Coupled Receptor Kinase 5, GPRK5) (MaxLight 750)

Sign In for Pricing
View Details