Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Rabbit Polyclonal Antibody (HRP)

DYRK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITES

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF682 Polyclonal Antibody
BT-AP09737-01 20 µL

ZNF682 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF682 Polyclonal Antibody
BT-AP09737-02 50 µL

ZNF682 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF682 Polyclonal Antibody
BT-AP09737-03 100 µL

ZNF682 Polyclonal Antibody

Sign In for Pricing
View Details
Thrb Mouse shRNA Lentiviral Particle (Locus ID 21834)
TL502280V 500 µL Each

Thrb Mouse shRNA Lentiviral Particle (Locus ID 21834)

Sign In for Pricing
View Details
Cbarp (NM_001108070) Rat Tagged Lenti ORF Clone
RR212572L3 10 µg

Cbarp (NM_001108070) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HAO1 CRISPR/Cas9 KO Plasmid (m)
sc-420794 20 µg

HAO1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details