Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Rabbit Polyclonal Antibody (FITC)

DYRK2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FLJ21217, FLJ21365

UniProt

Q92630

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: SVVLNGGRSRRGKLRGPPESREWGNALKGCDDPLFLDFLKQCLEWDPAVR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

60kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taok3 Mouse Gene Knockout Kit (CRISPR)
KN517174 1 Kit

Taok3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DNAJB6 Mouse Monoclonal Antibody [Clone ID: OTI5B5]
CF810677 100 µg

DNAJB6 Mouse Monoclonal Antibody [Clone ID: OTI5B5]

Sign In for Pricing
View Details
PINLYP Human Gene Knockout Kit (CRISPR)
KN430947 1 Kit

PINLYP Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Prolactin/PRL, C-His, Flag Tag
HA210676-01 20 µg

Human Prolactin/PRL, C-His, Flag Tag

Sign In for Pricing
View Details
Human Prolactin/PRL, C-His, Flag Tag
HA210676-02 50 µg

Human Prolactin/PRL, C-His, Flag Tag

Sign In for Pricing
View Details
Human Prolactin/PRL, C-His, Flag Tag
HA210676-03 100 µg

Human Prolactin/PRL, C-His, Flag Tag

Sign In for Pricing
View Details