Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAC Rabbit Polyclonal Antibody (Biotin)

STAC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

STAC1

UniProt

Q99469

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CASC3 Pre-designed siRNA Set A
SI002204A 1 Each

Human CASC3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
YCL022C Antibody
orb850329 2 mg

YCL022C Antibody

Sign In for Pricing
View Details
STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)
MBS6351647-01 0.1 mL

STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)

Sign In for Pricing
View Details
STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)
MBS6351647-02 5x 0.1 mL

STAC2, NT (STAC2, SH3 and cysteine-rich domain-containing protein 2, 24b2/STAC2, Src homology 3 and cysteine-rich domain-containing protein 2) (MaxLight 405)

Sign In for Pricing
View Details
Villin Rabbit pAb, BF700 conjugated
orb2868177 100 µL

Villin Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
HCV-1 e2 Protein (554-569) (TFA)
HY-P4027A 1 Each

HCV-1 e2 Protein (554-569) (TFA)

Sign In for Pricing
View Details