Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDC14A Rabbit Polyclonal Antibody (HRP)

CDC14A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Cdc14, DFNB32, DFNB35, hCDC14, DFNB105

UniProt

Q9UNH5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DDDVEMKNGITQGDKLRALKSQRQPRTSPSCAFRSDDTKGHPRAVSQPFR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003663

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (3-Chlorophenyl) -3-fluoropyrrolidine
PC510218 1 Each

3- (3-Chlorophenyl) -3-fluoropyrrolidine

Sign In for Pricing
View Details
Ephexin 1 (NGEF) (NM_001114090) Human Over-expression Lysate
E45H02519-2 20 µg

Ephexin 1 (NGEF) (NM_001114090) Human Over-expression Lysate

Sign In for Pricing
View Details
GPC2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
22447156 3x 1.0 µg DNA

GPC2 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Ang1 ORF Vector (Rat) (pORF)
ORF063381 1.0 µg DNA

Ang1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Gnao1 Polyclonal Antibody
A55105-020 20 µL

Gnao1 Polyclonal Antibody

Sign In for Pricing
View Details
Rat GDF15 (Growth Differentiation Factor 15) ELISA Kit
MBS2504245-01 24 Tests

Rat GDF15 (Growth Differentiation Factor 15) ELISA Kit

Sign In for Pricing
View Details