Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR3 Rabbit Polyclonal Antibody (HRP)

GPR3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ACCA

UniProt

P46089

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPLYTYLTLLPATYNSMINPIIYAFRNQDVQKVLWAVCCCCSSSKIPFRS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005272

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aspergillus discontinued
A3883-01B 1 mL

Aspergillus discontinued

Sign In for Pricing
View Details
PDE7A, NT (PDE7A, High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A, HCP1, TM22) (APC)
MBS6332200-01 0.2 mL

PDE7A, NT (PDE7A, High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A, HCP1, TM22) (APC)

Sign In for Pricing
View Details
PDE7A, NT (PDE7A, High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A, HCP1, TM22) (APC)
MBS6332200-02 5x 0.2 mL

PDE7A, NT (PDE7A, High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A, HCP1, TM22) (APC)

Sign In for Pricing
View Details
SOX30 polyclonal antibody
BS71755-01 50 µL

SOX30 polyclonal antibody

Sign In for Pricing
View Details
SOX30 polyclonal antibody
BS71755-02 100 µL

SOX30 polyclonal antibody

Sign In for Pricing
View Details
Lentiviral human MFF shRNA (UAS) - Lentiviral human MFF shRNA (UAS, RFP) (100)
GTR15151380 1 Vial

Lentiviral human MFF shRNA (UAS) - Lentiviral human MFF shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details