Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPR6 Rabbit Polyclonal Antibody (FITC)

GPR6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

J3KQR3

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human GPR6

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001273028.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human MECP2 Protein, N-His
AP91751 50 µg

Recombinant Human MECP2 Protein, N-His

Sign In for Pricing
View Details
Lentiviral human SLC7A13 shRNA (UAS) - Lentiviral human SLC7A13 shRNA (UAS, iRFP) (25)
GTR15320837 1 Vial

Lentiviral human SLC7A13 shRNA (UAS) - Lentiviral human SLC7A13 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Human Cell Adhesion Molecule 1 (CADM1) Protein
abx168190-01 10 µg

Human Cell Adhesion Molecule 1 (CADM1) Protein

Sign In for Pricing
View Details
Human Cell Adhesion Molecule 1 (CADM1) Protein
abx168190-02 50 µg

Human Cell Adhesion Molecule 1 (CADM1) Protein

Sign In for Pricing
View Details
Human Cell Adhesion Molecule 1 (CADM1) Protein
abx168190-03 100 µg

Human Cell Adhesion Molecule 1 (CADM1) Protein

Sign In for Pricing
View Details
Human Cell Adhesion Molecule 1 (CADM1) Protein
abx168190-04 200 µg

Human Cell Adhesion Molecule 1 (CADM1) Protein

Sign In for Pricing
View Details