Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSNAX Rabbit Polyclonal Antibody (FITC)

TSNAX Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

C3PO, TRAX

UniProt

Q99598

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVT

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005990

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Snail Antibody (20C8) [Janelia Fluor 646]
NBP2-50300JF646 0.1 mL

Mouse Monoclonal Snail Antibody (20C8) [Janelia Fluor 646]

Sign In for Pricing
View Details
HES7, NT (HES7, BHLHB37, Transcription factor HES-7, Class B basic helix-loop-helix protein 37, Hairy and enhancer of split 7, bHLH factor Hes7) (FITC)
MBS6306233-01 0.2 mL

HES7, NT (HES7, BHLHB37, Transcription factor HES-7, Class B basic helix-loop-helix protein 37, Hairy and enhancer of split 7, bHLH factor Hes7) (FITC)

Sign In for Pricing
View Details
HES7, NT (HES7, BHLHB37, Transcription factor HES-7, Class B basic helix-loop-helix protein 37, Hairy and enhancer of split 7, bHLH factor Hes7) (FITC)
MBS6306233-02 5x 0.2 mL

HES7, NT (HES7, BHLHB37, Transcription factor HES-7, Class B basic helix-loop-helix protein 37, Hairy and enhancer of split 7, bHLH factor Hes7) (FITC)

Sign In for Pricing
View Details
RPS3P3 3'UTR GFP Stable Cell Line
TU071780 1.0 mL

RPS3P3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AJAP1 Protein Vector (Human) (pPM-N-D-C-HA)
PV320800 500 ng

AJAP1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
EphA7 (Phospho-Tyr791) Colorimetric Cell-Based ELISA Kit
MBS9518773-01 1 Kit

EphA7 (Phospho-Tyr791) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details