Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAP2B Rabbit Polyclonal Antibody (HRP)

RAP2B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MGC20484

UniProt

P61225

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YERVPMILVGNKVDLEGEREVSYGEGKALAEEWSCPFMETSAKNKASVDE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002877

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DENND6A Protein, His (Fc)-Avi-tagged
DENND6A-2788H 50 µg

Recombinant Human DENND6A Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
SNN Protein Vector (Human) (pPM-C-HA)
PV130696 500 ng

SNN Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
UBE2E3 Peptide - N-terminal region (AAP43070)
AAP43070-100UG 100 µg

UBE2E3 Peptide - N-terminal region (AAP43070)

Sign In for Pricing
View Details
PTAFR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV694155 1.0 µg DNA

PTAFR Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat WNK Lysine Deficient Protein Kinase 3,WNK3 ELISA KIT
JOT-EK1404Ra-01 96 Well

Rat WNK Lysine Deficient Protein Kinase 3,WNK3 ELISA KIT

Sign In for Pricing
View Details
Rat WNK Lysine Deficient Protein Kinase 3,WNK3 ELISA KIT
JOT-EK1404Ra-02 48 Well

Rat WNK Lysine Deficient Protein Kinase 3,WNK3 ELISA KIT

Sign In for Pricing
View Details