Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA7A Rabbit Polyclonal Antibody (HRP)

SEMA7A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

JMH, CD108, SEMAL, CDw108, SEMAK1, H-Sema-L, H-SEMA-K1

UniProt

O75326

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human SEMA7A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKVSLAPNSRYYLSCPME

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003603

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNRC6A CRISPRa sgRNA lentivector (set of three targets)(Mouse)
47265124 3x 1.0µg DNA

TNRC6A CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Trp73 3'UTR GFP Stable Cell Line
TU171175 1.0 mL

Trp73 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)
MBS1228601-01 0.02 mg (E-Coli)

Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)
MBS1228601-02 0.1 mg (E-Coli)

Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)
MBS1228601-03 0.02 mg (Yeast)

Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)

Sign In for Pricing
View Details
Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)
MBS1228601-04 0.1 mg (Yeast)

Recombinant Nitratiruptor sp. Diaminopimelate epimerase (dapF)

Sign In for Pricing
View Details