Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE4C Rabbit Polyclonal Antibody (HRP)

PDE4C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DPDE1, PDE21

UniProt

Q08493

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGFIDYIAHPLWETW

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001092289

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit
MBS7281258-01 48 Well

Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit
MBS7281258-02 96 Well

Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit
MBS7281258-03 5x 96 Well

Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit

Sign In for Pricing
View Details
Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit
MBS7281258-04 10x 96 Well

Sheep anti Heat Shock 70kDa Protein 14 antibody ELISA Kit

Sign In for Pricing
View Details
4-Aminobutyric acid
MBS3605041-01 50 mg

4-Aminobutyric acid

Sign In for Pricing
View Details
4-Aminobutyric acid
MBS3605041-02 100 mg

4-Aminobutyric acid

Sign In for Pricing
View Details