Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10 Rabbit Polyclonal Antibody (FITC)

RPL10 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

QM, L10, NOV, AUTSX5, DXS648, MRXS35, DXS648E

UniProt

P27635

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), 0.2mg/mL
BNUB2480-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/2480), 0.2mg/mL

Sign In for Pricing
View Details
DM1 Mouse monoclonal Antibody [A4G2]
HA600013-50UL 50 µL

DM1 Mouse monoclonal Antibody [A4G2]

Sign In for Pricing
View Details
TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), CF488A conjugate, 0.1mg/mL
BNC881943-500 1x 500 µL

TIMP1 (Colorectal Cancer Biomarker / Marker of Lymph Node Metastasis) (rTIMP1/1710), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS639387 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Human FGF-16 Protein, His Tag
FG6-H51H3-100ug 100 µg

Human FGF-16 Protein, His Tag

Sign In for Pricing
View Details
DCTN1 / p150-glued Recombinant Rabbit monoclonal Antibody
HA723534 100 µL

DCTN1 / p150-glued Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details