Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10 Rabbit Polyclonal Antibody (HRP)

RPL10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

QM, L10, NOV, AUTSX5, DXS648, MRXS35, DXS648E

UniProt

P27635

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MGRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Secretion-regulating guanine nucleotide exchange factor (SERGEF) ELISA Kit
abx390508 96 Tests

Mouse Secretion-regulating guanine nucleotide exchange factor (SERGEF) ELISA Kit

Sign In for Pricing
View Details
GT-1 Antibody, HRP conjugated
CSB-PA861892LB01DOA-01 50 µg

GT-1 Antibody, HRP conjugated

Sign In for Pricing
View Details
GT-1 Antibody, HRP conjugated
CSB-PA861892LB01DOA-02 100 µg

GT-1 Antibody, HRP conjugated

Sign In for Pricing
View Details
HS6ST3 Rabbit Polyclonal Antibody (Cy5.5)
orb1069930 100 µL

HS6ST3 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
PLV3-U6-ITGAM (human) -sgRNA1-Cas9-EGFP-Puro
BZ58278 1 Vial

PLV3-U6-ITGAM (human) -sgRNA1-Cas9-EGFP-Puro

Sign In for Pricing
View Details
ZC3H7A CRISPR/Cas9 KO Plasmid (m)
sc-430643 20 µg

ZC3H7A CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details