Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10 Rabbit Polyclonal Antibody (HRP)

RPL10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

QM, L10, NOV, AUTSX5, DXS648, MRXS35, DXS648E

UniProt

P27635

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVA

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_006004

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Palmitoyl-protein thioesterase 1,PPT1 ELISA KIT
JOT-EK2325Mo-01 48 Well

Mouse Palmitoyl-protein thioesterase 1,PPT1 ELISA KIT

Sign In for Pricing
View Details
Mouse Palmitoyl-protein thioesterase 1,PPT1 ELISA KIT
JOT-EK2325Mo-02 96 Well

Mouse Palmitoyl-protein thioesterase 1,PPT1 ELISA KIT

Sign In for Pricing
View Details
Human MFAP5 (Microfibrillar-associated protein 5) ELISA Kit
orb2568739-01 48 Tests

Human MFAP5 (Microfibrillar-associated protein 5) ELISA Kit

Sign In for Pricing
View Details
Human MFAP5 (Microfibrillar-associated protein 5) ELISA Kit
orb2568739-02 96 Tests

Human MFAP5 (Microfibrillar-associated protein 5) ELISA Kit

Sign In for Pricing
View Details
Fractalkine Polyclonal Antibody
RA25097-01 50 µL

Fractalkine Polyclonal Antibody

Sign In for Pricing
View Details
Fractalkine Polyclonal Antibody
RA25097-02 100 µL

Fractalkine Polyclonal Antibody

Sign In for Pricing
View Details