Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL1 Rabbit Polyclonal Antibody (HRP)

MSL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MSL-1

UniProt

Q68DK7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001012241

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBM14 (RNA-binding Motif Protein 14, SIP, COAA, PSP2, SYTIP1, TMEM137) (MaxLight 650)
MBS6435117-01 0.1 mL

RBM14 (RNA-binding Motif Protein 14, SIP, COAA, PSP2, SYTIP1, TMEM137) (MaxLight 650)

Sign In for Pricing
View Details
RBM14 (RNA-binding Motif Protein 14, SIP, COAA, PSP2, SYTIP1, TMEM137) (MaxLight 650)
MBS6435117-02 5x 0.1 mL

RBM14 (RNA-binding Motif Protein 14, SIP, COAA, PSP2, SYTIP1, TMEM137) (MaxLight 650)

Sign In for Pricing
View Details
Polyclonal Antibody to E-selectin
TRV-0016675-01 20 µL

Polyclonal Antibody to E-selectin

Sign In for Pricing
View Details
Polyclonal Antibody to E-selectin
TRV-0016675-02 100 µL

Polyclonal Antibody to E-selectin

Sign In for Pricing
View Details
Polyclonal Antibody to E-selectin
TRV-0016675-03 200 µL

Polyclonal Antibody to E-selectin

Sign In for Pricing
View Details
Polyclonal Antibody to E-selectin
TRV-0016675-04 1 mL

Polyclonal Antibody to E-selectin

Sign In for Pricing
View Details