Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT6A Rabbit Polyclonal Antibody (FITC)

KRT6A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

K6A, K6C, K6D, PC3, CK6A, CK6C, CK6D, CK-6C, CK-6E, KRT6C, KRT6D

UniProt

P02538

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RGMQDLVEDFKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKAD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005545

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPP1 Protein Vector (Human) (pPM-C-His)
PV045344 500 ng

UPP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Pax6 (Paired Box Gene 6 (Aniridia, Keratitis), Paired Box Homeotic Gene 6, Paired Box Protein Pax-6, Pax-6, Aniridia Type II Protein, AN2, AN, D11S812E, MGC17209, MGDA, Oculorhombin, WAGR) (MaxLight 490)
MBS6492265-01 0.1 mL

Pax6 (Paired Box Gene 6 (Aniridia, Keratitis), Paired Box Homeotic Gene 6, Paired Box Protein Pax-6, Pax-6, Aniridia Type II Protein, AN2, AN, D11S812E, MGC17209, MGDA, Oculorhombin, WAGR) (MaxLight 490)

Sign In for Pricing
View Details
Pax6 (Paired Box Gene 6 (Aniridia, Keratitis), Paired Box Homeotic Gene 6, Paired Box Protein Pax-6, Pax-6, Aniridia Type II Protein, AN2, AN, D11S812E, MGC17209, MGDA, Oculorhombin, WAGR) (MaxLight 490)
MBS6492265-02 5x 0.1 mL

Pax6 (Paired Box Gene 6 (Aniridia, Keratitis), Paired Box Homeotic Gene 6, Paired Box Protein Pax-6, Pax-6, Aniridia Type II Protein, AN2, AN, D11S812E, MGC17209, MGDA, Oculorhombin, WAGR) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)
MBS7020468-01 0.02 mg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)
MBS7020468-02 0.1 mg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)
MBS7020468-03 5x 0.1 mg

Recombinant Staphylococcus aureus Putative antiporter subunit mnhC2 (mnhc2)

Sign In for Pricing
View Details