Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STXBP2 Rabbit Polyclonal Antibody (Biotin)

STXBP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FHL5, UNC18B, Hunc18b, UNC18-2, pp10122, MUNC18-2

UniProt

Q15833

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CMKHFKGSVEKLCSVEQDLAMGSDAEGEKIKDSMKLIVPVLLDAAVPAYD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_008880

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acrolein Diethyl Acetal
440931-01 1 g

Acrolein Diethyl Acetal

Sign In for Pricing
View Details
Acrolein Diethyl Acetal
440931-02 2.5 g

Acrolein Diethyl Acetal

Sign In for Pricing
View Details
MLK7-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV733615 1.0 µg DNA

MLK7-AS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mbnl1 (BC096600) Mouse Tagged ORF Clone
MR203170 10 µg

Mbnl1 (BC096600) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Accessory package for Anesthesia and Ventilator
R416-AP 1 PC

Accessory package for Anesthesia and Ventilator

Sign In for Pricing
View Details
Lentiviral mouse Rhpn2 shRNA (UAS) - Lentiviral mouse Rhpn2 shRNA (UAS) (100)
GTR15297741 1 Vial

Lentiviral mouse Rhpn2 shRNA (UAS) - Lentiviral mouse Rhpn2 shRNA (UAS) (100)

Sign In for Pricing
View Details