Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Oprm1 Rabbit Polyclonal Antibody (Biotin)

Oprm1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

O, m, MO, mu, mor, Oprm, muOR, MOP-R, MOR-1, M-OR-1, MOR-1O

UniProt

P42866

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Oprm1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001034741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quantifoil R 2/4; Nickel 200 Mesh 100/pk
M-CEM-Q2100NR4 100 Grids

Quantifoil R 2/4; Nickel 200 Mesh 100/pk

Sign In for Pricing
View Details
Lentiviral mouse Oard1 shRNA (UAS) - Lentiviral mouse Oard1 shRNA (UAS, GFP) (100)
GTR15271353 1 Vial

Lentiviral mouse Oard1 shRNA (UAS) - Lentiviral mouse Oard1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Rat Amphoterin-induced protein 1, His, Mammal-20ug
QP10134-ma-20ug 20ug

Recombinant Rat Amphoterin-induced protein 1, His, Mammal-20ug

Sign In for Pricing
View Details
Apelin Polyclonal Antibody
MBS9245780-01 0.1 mL

Apelin Polyclonal Antibody

Sign In for Pricing
View Details
Apelin Polyclonal Antibody
MBS9245780-02 5x 0.1 mL

Apelin Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human SCG3 Protein
CRP2239-01 10 µg

Recombinant Human SCG3 Protein

Sign In for Pricing
View Details