Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPRC6A Rabbit Polyclonal Antibody (HRP)

GPRC6A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GPCR, bA86F4.3

UniProt

Q5T6X5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human GPRC6A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQPCQTPDDFVAATSPGHIIIGGLFAIHEKMLSSEDSPRRPQIQECVGFE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_683766

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Rat CA2 (Carbonic Anhydrase ?)
E-EL-R0147 96 Tests

ELISA kit for Rat CA2 (Carbonic Anhydrase ?)

Sign In for Pricing
View Details
RPL21P121 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV778097 1.0 µg DNA

RPL21P121 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
HIST1H2BB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0956207 1.0 µg DNA

HIST1H2BB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Antibody (HRP)
abx108233-01 20 µg

Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Antibody (HRP)

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Antibody (HRP)
abx108233-02 50 µg

Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Antibody (HRP)

Sign In for Pricing
View Details
Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Antibody (HRP)
abx108233-03 100 µg

Eukaryotic Translation Initiation Factor 4E-Binding Protein 2 (EIF4EBP2) Antibody (HRP)

Sign In for Pricing
View Details