Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPRC6A Rabbit Polyclonal Antibody (FITC)

GPRC6A Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GPCR, bA86F4.3

UniProt

Q5T6X5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NVTMTNPSSSGKSATWQKSKDLQAQAFAHICRENATSVSKTLPRKRMSSI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

83kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Yeast

Tested Applications

WB

NCBI Accession Number

AAS13466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)
MBS2078484-01 0.1 mL

Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)
MBS2078484-02 0.2 mL

Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)
MBS2078484-03 0.5 mL

Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)
MBS2078484-04 1 mL

Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)
MBS2078484-05 5 mL

Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)
MBS2078484-06 5x 5 mL

Cy3-Linked Polyclonal Antibody to RNA Binding Motif Protein 38 (RBM38)

Sign In for Pricing
View Details