Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPIHBP1 Rabbit Polyclonal Antibody (FITC)

GPIHBP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HYPL1D, GPI-HBP1

UniProt

Q8IV16

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GPIHBP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_835466

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H3 Monoclonal Antibody, Cy5 Conjugated
UB-GEN-4506 100 µL

Histone H3 Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (Biotin)
MBS6381410-01 0.1 mL

HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (Biotin)

Sign In for Pricing
View Details
HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (Biotin)
MBS6381410-02 5x 0.1 mL

HNF4A (Hepatocyte Nuclear Factor 4-alpha, HNF-4-alpha, Transcription Factor HNF-4, Nuclear Receptor Subfamily 2 Group A Member 1, Transcription Factor 14, HNF4, NR2A1, TCF14) (Biotin)

Sign In for Pricing
View Details
ELAVL4 Rabbit Polyclonal Antibody (Fluoro647)
orb3076171 100 µg

ELAVL4 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Zfp825 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
51149154 3x 1.0 µg DNA

Zfp825 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Recombinant Mouse Apoptosis-associated speck-like protein containing a CARD (Pycard), partial
orb1674391-01 20 µg

Recombinant Mouse Apoptosis-associated speck-like protein containing a CARD (Pycard), partial

Sign In for Pricing
View Details