Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm11686 Rabbit Polyclonal Antibody (FITC)

Gm11686 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OTTMUSG00000003369

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Gm11686

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGLLKASLSGRLWGKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001480424

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mebeverine Acid
TRC-M202500-5MG 5 mg

Mebeverine Acid

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS509642 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Dcaf1 Mouse Gene Knockout Kit (CRISPR)
KN519238 1 Kit

Dcaf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hybex™ Erlenmeyer Flask, 500ml, case of 6
B3110-500 1 Each

Hybex™ Erlenmeyer Flask, 500ml, case of 6

Sign In for Pricing
View Details
SLC25A34 Human qPCR Primer Pair (NM_207348)
HP219667 200 Reactions

SLC25A34 Human qPCR Primer Pair (NM_207348)

Sign In for Pricing
View Details
CD19 Mouse Monoclonal Antibody [Clone ID: HD37]
AM39014RP-N 100 Tests

CD19 Mouse Monoclonal Antibody [Clone ID: HD37]

Sign In for Pricing
View Details