Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gm11686 Rabbit Polyclonal Antibody (FITC)

Gm11686 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OTTMUSG00000003369

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Gm11686

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PGLLKASLSGRLWGKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001480424

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Synaptonemal Complex Protein 3 (SYCP3) ELISA Kit
RD-SYCP3-Hu-01 96 Tests

Human Synaptonemal Complex Protein 3 (SYCP3) ELISA Kit

Sign In for Pricing
View Details
Human Synaptonemal Complex Protein 3 (SYCP3) ELISA Kit
RD-SYCP3-Hu-02 48 Tests

Human Synaptonemal Complex Protein 3 (SYCP3) ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR563048 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details
Gradient Thermal Cycler BTHC-601
BTHC-601 1 Unit

Gradient Thermal Cycler BTHC-601

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (rCLIP/1418), CF405S conjugate, 0.1mg/mL
BNC043176-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (C-Terminus) (rCLIP/1418), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF568 conjugate, 0.1mg/mL
BNC682383-500 1x 500 µL

CD40 / TNFRSF5 / CD40L-Receptor (C40/2383), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details