Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPC4 Rabbit Polyclonal Antibody (Biotin)

GPC4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KPTS, K-glypican

UniProt

B4E2C0

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human GPC4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYLLTVFCILFLVMQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001439.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (FITC)
MBS6329100-01 0.2 mL

OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (FITC)

Sign In for Pricing
View Details
OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (FITC)
MBS6329100-02 5x 0.2 mL

OR52I2, CT (OR52I2, Olfactory receptor 52I2, Olfactory receptor OR11-12) (FITC)

Sign In for Pricing
View Details
ADAT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
11383124 3x 1.0µg DNA

ADAT3 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Calreticulin (CALR, SSA, Sicca Syndrome Antigen A, Ro, Autoantigen Ro)
C1036 200 µg

Calreticulin (CALR, SSA, Sicca Syndrome Antigen A, Ro, Autoantigen Ro)

Sign In for Pricing
View Details
SGK1 (4D12) Mouse Monoclonal Antibody
AMM17819-01 50 µL

SGK1 (4D12) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SGK1 (4D12) Mouse Monoclonal Antibody
AMM17819-02 100 µL

SGK1 (4D12) Mouse Monoclonal Antibody

Sign In for Pricing
View Details