Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT9 Rabbit Polyclonal Antibody (Biotin)

KRT9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

K9, CK-9, EPPK

UniProt

P35527

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human KRT9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_000217.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rhesus Macaque TIA1 Protein, His (Fc)-Avi-tagged
TIA1-4524R 50 µg

Recombinant Rhesus Macaque TIA1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
DEFB1 Antibody Blocking Peptide
orb86001 500 µg

DEFB1 Antibody Blocking Peptide

Sign In for Pricing
View Details
Human Anti M2 cholinergic receptor antibodies ELISA Kit
MBS733844-01 48 Well

Human Anti M2 cholinergic receptor antibodies ELISA Kit

Sign In for Pricing
View Details
Human Anti M2 cholinergic receptor antibodies ELISA Kit
MBS733844-02 96 Well

Human Anti M2 cholinergic receptor antibodies ELISA Kit

Sign In for Pricing
View Details
Human Anti M2 cholinergic receptor antibodies ELISA Kit
MBS733844-03 5x 96 Well

Human Anti M2 cholinergic receptor antibodies ELISA Kit

Sign In for Pricing
View Details
Human Anti M2 cholinergic receptor antibodies ELISA Kit
MBS733844-04 10x 96 Well

Human Anti M2 cholinergic receptor antibodies ELISA Kit

Sign In for Pricing
View Details