Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT9 Rabbit Polyclonal Antibody (Biotin)

KRT9 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

K9, CK-9, EPPK

UniProt

P35527

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT9

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEI

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000217

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EF-CBP2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9016R-BF555 100 µL

EF-CBP2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal RBKS Antibody [CoraFluor 1]
NBP2-97078CL1 0.1 mL

Rabbit Polyclonal RBKS Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Comb 30 sample 1mm thick
VS20301 1 Each

Comb 30 sample 1mm thick

Sign In for Pricing
View Details
CCL4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-2475R-BF405-01 20 µL

CCL4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
CCL4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-2475R-BF405-02 100 µL

CCL4 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Recombinant Human UPF0767 protein C1orf212 (C1orf212)
MBS7010547-01 0.02 mg

Recombinant Human UPF0767 protein C1orf212 (C1orf212)

Sign In for Pricing
View Details