Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27 Rabbit Polyclonal Antibody (Biotin)

RPS27 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S27, MPS1, DBA17, MPS-1

UniProt

Q5T4L6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat TNC (Tenascin C) ELISA Kit
ELK5764-01 48 Tests

Rat TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details
Rat TNC (Tenascin C) ELISA Kit
ELK5764-02 96 Tests

Rat TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details
Rat TNC (Tenascin C) ELISA Kit
ELK5764-03 5x 96 Tests

Rat TNC (Tenascin C) ELISA Kit

Sign In for Pricing
View Details
IFluor® 430 Anti-human CD172a Antibody *15-414*
11720031-AAT 500 Tests

IFluor® 430 Anti-human CD172a Antibody *15-414*

Sign In for Pricing
View Details
ACBD5 Protein Vector (Rat) (pPB-N-His)
PV251735 500 ng

ACBD5 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Human Disintegrin and metalloproteinase domain-containing protein 28 (ADAM28) ELISA Kit
RK10245 96 Tests

Human Disintegrin and metalloproteinase domain-containing protein 28 (ADAM28) ELISA Kit

Sign In for Pricing
View Details