Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27 Rabbit Polyclonal Antibody (Biotin)

RPS27 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S27, MPS1, DBA17, MPS-1

UniProt

Q5T4L6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Boydii rpmI Protein (aa 1-65) (strain CDC 3083-94 / BS512)
VAng-Lsx09357-50gEcoli 50 µg (E. coli)

Recombinant Shigella Boydii rpmI Protein (aa 1-65) (strain CDC 3083-94 / BS512)

Sign In for Pricing
View Details
SIRT1 Polyclonal Antibody
A-4700-100 100 µL

SIRT1 Polyclonal Antibody

Sign In for Pricing
View Details
WNT3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]
TA801866AM 100 µL

WNT3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1C7]

Sign In for Pricing
View Details
ATF2 (Phospho-Thr69 or 51) DNA-Binding ELISA Kit (OKAG00297)
OKAG00297 96 Well

ATF2 (Phospho-Thr69 or 51) DNA-Binding ELISA Kit (OKAG00297)

Sign In for Pricing
View Details
IGHV3OR15-7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV729556 1.0 µg DNA

IGHV3OR15-7 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Gtf2a1l sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4036002 1.0 µg DNA

Gtf2a1l sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details