Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27 Rabbit Polyclonal Antibody (HRP)

RPS27 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S27, MPS1, DBA17, MPS-1

UniProt

Q5T4L6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

9kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001021

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-p53(T18) Antibody Blocking peptide
MBS9225052-01 0.5 mg

Phospho-p53(T18) Antibody Blocking peptide

Sign In for Pricing
View Details
Phospho-p53(T18) Antibody Blocking peptide
MBS9225052-02 5x 0.5 mg

Phospho-p53(T18) Antibody Blocking peptide

Sign In for Pricing
View Details
ELOVL6 Polyclonal Antibody, Biotin Conjugated
bs-7055R-Biotin 100 µL

ELOVL6 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal CCRL2/CRAM-A/B Antibody (BZ2E3) [Janelia Fluor 549]
NBP3-11982JF549 0.1 mL

Rabbit Monoclonal CCRL2/CRAM-A/B Antibody (BZ2E3) [Janelia Fluor 549]

Sign In for Pricing
View Details
TSLC1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb891807 100 µL

TSLC1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
IREB2 Rabbit Polyclonal Antibody
TA345869 100 µL

IREB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details