Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps27l Rabbit Polyclonal Antibody (FITC)

Rps27l Rabbit Polyclonal Antibody (FITC)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Rps27l

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001056747

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPA Antibody, Biotin conjugated
A51648-100UG 100 µg

LPA Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral human CERT1 shRNA (UAS) - Lentiviral human CERT1 shRNA (UAS, RFP) plasmid
GTR15086533 1 Vial

Lentiviral human CERT1 shRNA (UAS) - Lentiviral human CERT1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Human VEGF-A ELISA (total)
MBS691468-01 0.096 mg

Human VEGF-A ELISA (total)

Sign In for Pricing
View Details
Human VEGF-A ELISA (total)
MBS691468-02 5x 0.09 6mg

Human VEGF-A ELISA (total)

Sign In for Pricing
View Details
DNA Polymerase alpha Antibody / POLA1 (N-Terminal Region)
F54189-0.2ML 0.2 mL

DNA Polymerase alpha Antibody / POLA1 (N-Terminal Region)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Cystatin 1 (CST1)
MBS2168368-01 0.1 mL

HRP-Linked Monoclonal Antibody to Cystatin 1 (CST1)

Sign In for Pricing
View Details