Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rps27l Rabbit Polyclonal Antibody (HRP)

Rps27l Rabbit Polyclonal Antibody (HRP)

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat Rps27l

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

12kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_001056747

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttll7 ORF Vector (Mouse) (pORF)
ORF060722 1.0 µg DNA

Ttll7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
IFT80 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV660514 1.0 µg DNA

IFT80 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
CD367/CLEC4A, Mouse (Myc, His-SUMO)
HY-P71636 1 Each

CD367/CLEC4A, Mouse (Myc, His-SUMO)

Sign In for Pricing
View Details
RNF14 Antibody - C-terminal region (ARP82569_P050)
ARP82569_P050 100 µL

RNF14 Antibody - C-terminal region (ARP82569_P050)

Sign In for Pricing
View Details
1/4 Hose Barb Non-Valved Class VI Polycarbonate Coupling Insert
BIOBGMPC22004T03M 1 Piece/Case:1 Piece/ PACKS:1 PACKS/CASE

1/4 Hose Barb Non-Valved Class VI Polycarbonate Coupling Insert

Sign In for Pricing
View Details
B3GALT5 Adenovirus (Human)
12929051 1.0 mL

B3GALT5 Adenovirus (Human)

Sign In for Pricing
View Details