Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYFIP1 Rabbit Polyclonal Antibody (HRP)

CYFIP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SHYC, SRA1, SRA-1, P140SRA-1

UniProt

Q7L576

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYFIP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: WAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERI

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

145kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055423

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDNF Receptor alpha 2 (GFRA2) Chicken Polyclonal Antibody
AP33456PU-N 100 µg

GDNF Receptor alpha 2 (GFRA2) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
SLC6A6 Human Gene Knockout Kit (CRISPR)
KN419698 1 Kit

SLC6A6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
COMMD5 (NM_001081004) Human Over-expression Lysate
LY421150 100 µg

COMMD5 (NM_001081004) Human Over-expression Lysate

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details