Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS10 Rabbit Polyclonal Antibody (HRP)

RPS10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S10, DBA9

UniProt

P46783

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKGLEGERPARLTRGEADRDTYRRSAVPPGADKKAEAGAGSATEFQFRGG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR179 shRNA Plasmid (m)
sc-145727-SH 20 µg

GPR179 shRNA Plasmid (m)

Sign In for Pricing
View Details
500mL PETG Square Storage Bottle with Bi-directional Transfer Cap with TPE Tube (60cm 1/8" ID 1/4" OD), Female Luer Lock Connector with Luer Plug, Vent Filter (0.22 μm Φ24mm), Sterile, 1/pk, 10/cs
CS0016-C51022-AGB060A 1 Each

500mL PETG Square Storage Bottle with Bi-directional Transfer Cap with TPE Tube (60cm 1/8" ID 1/4" OD), Female Luer Lock Connector with Luer Plug, Vent Filter (0.22 μm Φ24mm), Sterile, 1/pk, 10/cs

Sign In for Pricing
View Details
Recombinant Toxocara Canis Large Ribosomal Subunit Protein uL5 (RPL11)
VG2C54-01 1 mg

Recombinant Toxocara Canis Large Ribosomal Subunit Protein uL5 (RPL11)

Sign In for Pricing
View Details
Recombinant Toxocara Canis Large Ribosomal Subunit Protein uL5 (RPL11)
VG2C54-02 100 µg

Recombinant Toxocara Canis Large Ribosomal Subunit Protein uL5 (RPL11)

Sign In for Pricing
View Details
Recombinant Toxocara Canis Large Ribosomal Subunit Protein uL5 (RPL11)
VG2C54-03 20 µg

Recombinant Toxocara Canis Large Ribosomal Subunit Protein uL5 (RPL11)

Sign In for Pricing
View Details
Mouse CD49e Antibody : FITC
OASB00487-500UG 0.5 mg

Mouse CD49e Antibody : FITC

Sign In for Pricing
View Details