Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX2 Rabbit Polyclonal Antibody (FITC)

SNX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

TRG-9

UniProt

O60749

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EWEAKVQQGERDFEQISKTIRKEVGRFEKERVKDFKTVIIKYLESLVQTQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003091

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human RAB23 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424603-01 0.12 mL

Rabbit Anti Human RAB23 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
Rabbit Anti Human RAB23 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)
MBS8424603-02 5x 0.12 mL

Rabbit Anti Human RAB23 Polyclonal Antigen Affinity Purified (PBS with 0.05% sodium azide and 40% Glycerol, pH7.4)(IHC, ELISA)

Sign In for Pricing
View Details
UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (Azide free) (HRP) discontinued
U1000-86B-HRP 200 µL

UBE2C, CT (Ubiquitin-conjugating Enzyme E2 C, Ubiquitin-protein Ligase C, Ubiquitin Carrier Protein C, UbcH10) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
ZC3HC1 Conjugated Antibody
MBS9448937-01 0.1 mL (Biotin)

ZC3HC1 Conjugated Antibody

Sign In for Pricing
View Details
ZC3HC1 Conjugated Antibody
MBS9448937-02 0.1 mL (AF350)

ZC3HC1 Conjugated Antibody

Sign In for Pricing
View Details
ZC3HC1 Conjugated Antibody
MBS9448937-03 0.1 mL (AF405)

ZC3HC1 Conjugated Antibody

Sign In for Pricing
View Details