Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DRP2 Rabbit Polyclonal Antibody (HRP)

DRP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DRP-2

UniProt

Q13474

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LEEPHSESKDTSPKQRIQNLSRFVWKQATVASELWEKLTARCVDQHRHIE

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

EAX02845

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WNT3 Peptide
orb1233366 0.1 mg

WNT3 Peptide

Sign In for Pricing
View Details
HM13, CT (HM13, H13, IMP1, PSL3, SPP, Minor histocompatibility antigen H13, Intramembrane protease 1, Presenilin-like protein 3, Signal peptide peptidase) (AP)
MBS6307176-01 0.2 mL

HM13, CT (HM13, H13, IMP1, PSL3, SPP, Minor histocompatibility antigen H13, Intramembrane protease 1, Presenilin-like protein 3, Signal peptide peptidase) (AP)

Sign In for Pricing
View Details
HM13, CT (HM13, H13, IMP1, PSL3, SPP, Minor histocompatibility antigen H13, Intramembrane protease 1, Presenilin-like protein 3, Signal peptide peptidase) (AP)
MBS6307176-02 5x 0.2 mL

HM13, CT (HM13, H13, IMP1, PSL3, SPP, Minor histocompatibility antigen H13, Intramembrane protease 1, Presenilin-like protein 3, Signal peptide peptidase) (AP)

Sign In for Pricing
View Details
Mouse Kptn Pre-designed siRNA Set B
SI107315B 1 Each

Mouse Kptn Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Sulfurtransferase TusD (tusD)
MBS1316775-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Sulfurtransferase TusD (tusD)

Sign In for Pricing
View Details
Recombinant Shigella flexneri serotype 5b Sulfurtransferase TusD (tusD)
MBS1316775-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri serotype 5b Sulfurtransferase TusD (tusD)

Sign In for Pricing
View Details