Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTRA3 Rabbit Polyclonal Antibody (HRP)

HTRA3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Prsp, Tasp

UniProt

P83110

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TNAHVVSSNSAAPGRQQLKVQLQNGDSYEATIKDIDKKSDIATIKIHPKK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_444272

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen VII (LH7.2), CF640R conjugate, 0.1mg/mL
BNC402315-100 1x 100 µL

Collagen VII (LH7.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) (rKRT18/1190), CF405S conjugate, 0.1mg/mL
BNC043217-100 1x 100 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Helicase Protein (His Tag)
PKSR030466-01 10 µg

Recombinant SARS-CoV-2 Helicase Protein (His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Helicase Protein (His Tag)
PKSR030466-02 50 µg

Recombinant SARS-CoV-2 Helicase Protein (His Tag)

Sign In for Pricing
View Details
TOC Analyzer BANA-603
BANA-603 Each

TOC Analyzer BANA-603

Sign In for Pricing
View Details
CD1a (O10), 0.2mg/mL
BNUB0667-100 1x 100 µL

CD1a (O10), 0.2mg/mL

Sign In for Pricing
View Details