Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Iqgap2 Rabbit Polyclonal Antibody (Biotin)

Iqgap2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI788777, A630053O10, 4933417J23Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Iqgap2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

180kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ilf2 Antibody - N-terminal region
MBS3203555-01 0.1 mL

Ilf2 Antibody - N-terminal region

Sign In for Pricing
View Details
Ilf2 Antibody - N-terminal region
MBS3203555-02 5x 0.1 mL

Ilf2 Antibody - N-terminal region

Sign In for Pricing
View Details
Recombinant Brachybacterium faecium AAA ATPase forming ring-shaped complexes (arc), partial
MBS1055634 Inquire

Recombinant Brachybacterium faecium AAA ATPase forming ring-shaped complexes (arc), partial

Sign In for Pricing
View Details
Rat CCR9 Alexa Fluor 488 Antibody (Clone 882416)
FAB8287G-100UG 100 µg

Rat CCR9 Alexa Fluor 488 Antibody (Clone 882416)

Sign In for Pricing
View Details
PCMV-PIWIL2-3xFLAG-Neo Plasmid
PVT66748 2 µg

PCMV-PIWIL2-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
IFluor® 450 Anti-human CD87 Antibody *VIM5*
10870040-AAT 100 Tests

IFluor® 450 Anti-human CD87 Antibody *VIM5*

Sign In for Pricing
View Details