Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Iqgap2 Rabbit Polyclonal Antibody (Biotin)

Iqgap2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI788777, A630053O10, 4933417J23Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Iqgap2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

180kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC90B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
15329061 1.0 µg DNA

CCDC90B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, MED) (MaxLight 405) discontinued
133026-ML405 100 µL

SCN8A (Sodium Channel Protein Type 8 Subunit alpha, Sodium Channel Protein Type VIII Subunit alpha, Voltage-gated Sodium Channel Subunit alpha Nav1.6, MED) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Anti-COL9A1 Antibody Picoband® Fluoro594 Conjugated
A04554-3-Fluoro594 100 µg/Vial

Anti-COL9A1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Arhgef7 Mouse siRNA Oligo Duplex (Locus ID 54126)
SR418629 1 Kit

Arhgef7 Mouse siRNA Oligo Duplex (Locus ID 54126)

Sign In for Pricing
View Details
Compound EN300-55027
TPL0451-01 200 mg

Compound EN300-55027

Sign In for Pricing
View Details
Compound EN300-55027
TPL0451-02 5 mg

Compound EN300-55027

Sign In for Pricing
View Details