Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Iqgap2 Rabbit Polyclonal Antibody (FITC)

Iqgap2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AI788777, A630053O10, 4933417J23Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Iqgap2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

180kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem121 Mouse Gene Knockout Kit (CRISPR)
KN517707 1 Kit

Tmem121 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PSG7 Human Gene Knockout Kit (CRISPR)
KN421648 1 Kit

PSG7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL
BNC400826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit
E-UNEL-R0087-01 5x 96 Tests

Uncoated Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit
E-UNEL-R0087-02 15x 96 Tests

Uncoated Rat LBP (Lipopolysaccharide Binding Protein) ELISA Kit

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), Biotin conjugate, 0.1mg/mL
BNCB0828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details