Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Iqgap2 Rabbit Polyclonal Antibody (HRP)

Iqgap2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AI788777, A630053O10, 4933417J23Rik

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Iqgap2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DNLKRKNSRRSIKLDGKAEPKGTKRVKPVRYTAAKLHDKGVLLGIDDLQT

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

180kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_081987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scp2 (NM_138508) Rat Tagged Lenti ORF Clone
RR201232L3 10 µg

Scp2 (NM_138508) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse CLEC18A siRNA
abx912018-01 15 nmol

Mouse CLEC18A siRNA

Sign In for Pricing
View Details
Mouse CLEC18A siRNA
abx912018-02 30 nmol

Mouse CLEC18A siRNA

Sign In for Pricing
View Details
11-deoxy Prostaglandin E2
sc-204962 1 mg

11-deoxy Prostaglandin E2

Sign In for Pricing
View Details
BANP (NM_017869) Human Over-expression Lysate
LH10435V 100 µg

BANP (NM_017869) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Cronobacter sakazakii HTH-type transcriptional repressor fabR (fabR)
MBS1139256-01 0.02 mg (E-Coli)

Recombinant Cronobacter sakazakii HTH-type transcriptional repressor fabR (fabR)

Sign In for Pricing
View Details