Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL1 Rabbit Polyclonal Antibody (HRP)

ANGPTL1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ANG3, ARP1, AngY, ANGPT3, UNQ162, dJ595C2.2

UniProt

O95841

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ANGPTL1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PDLATSPTKSPFKIPPVTFINEGPFKDCQQAKEAGHSVNGIFWAEYRGGS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004664.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BOD Incubator BIBD-104
BIBD-104 1 Unit

BOD Incubator BIBD-104

Sign In for Pricing
View Details
NAALADL1 Human Gene Knockout Kit (CRISPR)
KN417792 1 Kit

NAALADL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C1QB / Complement C1q B-Chain (C1QB/2965), CF568 conjugate, 0.1mg/mL
BNC682965-100 1x 100 µL

C1QB / Complement C1q B-Chain (C1QB/2965), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS803881 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Retinoic Acid Receptor gamma (RARG) (NM_001042728) Human Over-expression Lysate
LC420799 20 µg

Retinoic Acid Receptor gamma (RARG) (NM_001042728) Human Over-expression Lysate

Sign In for Pricing
View Details
Bax (2D2), Biotin conjugate, 0.1mg/mL
BNCB0004-500 1x 500 µL

Bax (2D2), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details