Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPTL1 Rabbit Polyclonal Antibody (FITC)

ANGPTL1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ANG3, ARP1, AngY, ANGPT3, UNQ162, dJ595C2.2

UniProt

O95841

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ANGPTL1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPICVNTKGQDASTIKDM

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Ankrd11 shRNA (UAS) - Lentiviral mouse Ankrd11 shRNA (UAS, iRFP) (25)
GTR15295997 1 Vial

Lentiviral mouse Ankrd11 shRNA (UAS) - Lentiviral mouse Ankrd11 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
SLC35E1 Protein Vector (Rat) (pPM-C-His)
PV305969 500 ng

SLC35E1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
HFM1 Rabbit pAb, AP conjugated
orb2844340 100 µL

HFM1 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
TLR2, ID (TLR2, TIL4, Toll-like receptor 2, Toll/interleukin-1 receptor-like protein 4, CD282) (MaxLight 650)
MBS6355863-01 0.1 mL

TLR2, ID (TLR2, TIL4, Toll-like receptor 2, Toll/interleukin-1 receptor-like protein 4, CD282) (MaxLight 650)

Sign In for Pricing
View Details
TLR2, ID (TLR2, TIL4, Toll-like receptor 2, Toll/interleukin-1 receptor-like protein 4, CD282) (MaxLight 650)
MBS6355863-02 5x 0.1 mL

TLR2, ID (TLR2, TIL4, Toll-like receptor 2, Toll/interleukin-1 receptor-like protein 4, CD282) (MaxLight 650)

Sign In for Pricing
View Details
Gsg1 ORF Vector (Rat) (pORF)
ORF067936 1.0 µg DNA

Gsg1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details