Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

G6pc3 Rabbit Polyclonal Antibody (FITC)

G6pc3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

UGRP, AU019276, AU045429, AV128920, AW545836, 0710001K01Rik

UniProt

Q6NSQ9

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse G6pc3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PEWVHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNGQKIAC

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_787949

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGALS8 Antibody
E19-8262-1 50 µg - 50 µL

LGALS8 Antibody

Sign In for Pricing
View Details
Rat ANXA2 (Annexin A2) QuickTest ELISA Kit
MBS7619430-01 48 Well

Rat ANXA2 (Annexin A2) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat ANXA2 (Annexin A2) QuickTest ELISA Kit
MBS7619430-02 96 Well

Rat ANXA2 (Annexin A2) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat ANXA2 (Annexin A2) QuickTest ELISA Kit
MBS7619430-03 5x 96 Well

Rat ANXA2 (Annexin A2) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat ANXA2 (Annexin A2) QuickTest ELISA Kit
MBS7619430-04 10x 96 Well

Rat ANXA2 (Annexin A2) QuickTest ELISA Kit

Sign In for Pricing
View Details
SREBP2 Polyclonal Antibody, APC Conjugated
bs-2536R-APC 100 µL

SREBP2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details