Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1 Rabbit Polyclonal Antibody (HRP)

HRH1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

H1R, H1-R, HH1R, hisH1

UniProt

P35367

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_000852

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human keyhole limpet hemocyanin Antibody IgM, KLH Ab IgM ELISA KIT
ED0357Hu-01 96 Well

Human keyhole limpet hemocyanin Antibody IgM, KLH Ab IgM ELISA KIT

Sign In for Pricing
View Details
Human keyhole limpet hemocyanin Antibody IgM, KLH Ab IgM ELISA KIT
ED0357Hu-02 5x 96 Tests

Human keyhole limpet hemocyanin Antibody IgM, KLH Ab IgM ELISA KIT

Sign In for Pricing
View Details
Human keyhole limpet hemocyanin Antibody IgM, KLH Ab IgM ELISA KIT
ED0357Hu-03 10x 96 Tests

Human keyhole limpet hemocyanin Antibody IgM, KLH Ab IgM ELISA KIT

Sign In for Pricing
View Details
Non-sterile MCE Syringe Filters, 0.22 (μm), 4 (mm), 100pcs/pk
11034225 100 PCS

Non-sterile MCE Syringe Filters, 0.22 (μm), 4 (mm), 100pcs/pk

Sign In for Pricing
View Details
4- (4-Nitrophenylazo) -1-naphthol
285441-01 100 g

4- (4-Nitrophenylazo) -1-naphthol

Sign In for Pricing
View Details
4- (4-Nitrophenylazo) -1-naphthol
285441-02 250 g

4- (4-Nitrophenylazo) -1-naphthol

Sign In for Pricing
View Details